PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05322.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TALE
Protein Properties Length: 467aa    MW: 50481.7 Da    PI: 7.0856
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05322.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.4e-094044421854
                                   HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   +Fe+   +yp+ +e+e LA++ gL+ +qV++WF N R +
  Zmw_sc05322.1.g00050.1.sm.mk 404 MFENflRPYPKDSEKEMLAARSGLSRSQVSNWFINARVR 442
                                   57766689*****************************88 PP

2BELL22.62.7e-08272339572
                          BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   +++ ++ Ll+ll+ +d+r +q+ +++q  +s +  ++  g  ++ + +   a+S  +r L+ +i+  i
  Zmw_sc05322.1.g00050.1.sm.mk 272 HHRLRNDLLKLLQLMDQRCNQCLDEMQSAASKYGSMVRPGGGALSAPFSYTAVSAMHRRLRARIIAEI 339
                                   5666789*********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.4E-18208335IPR006563POX domain
PROSITE profilePS5007111.985383446IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-25385457IPR009057Homeodomain-like
SMARTSM003898.9E-8386450IPR001356Homeobox domain
CDDcd000862.80E-12386447No hitNo description
SuperFamilySSF466897.27E-16386454IPR009057Homeodomain-like
PfamPF059207.3E-16403442IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MGNASCQQLG VDAMMSNSCF DSNMVGADVA TMVHVPEYMA HDGSLGLGGH FLADGGAVLA  60
GQLQLVRPAV PQSLSPQEVH GAFSVASGYG PSPSDVTAAL PPTAAKLAGE PESSWLQEQY  120
HGPTWFSGAG FRDPFTAAAR ELSLRLAAES SSTGTVVNLP DQSSDVSCSG LTHAGSSAAH  180
GLIQPPYCGG GDDQLGRARR GRPHFSHVLS RSGYAHIVQQ TLDEFVGCLL QDVAGATGSV  240
VGEAHCPLPS SSSSITTPSD QFMFAGAEEH PHHRLRNDLL KLLQLMDQRC NQCLDEMQSA  300
ASKYGSMVRP GGGALSAPFS YTAVSAMHRR LRARIIAEIA SVTQTQRGRE QTSSGSLADR  360
ERSWESAFIQ KHWALRQLRR GDQQSWRPQR GLPEKSVAVL KAWMFENFLR PYPKDSEKEM  420
LAARSGLSRS QVSNWFINAR VRLWKPMIEE MYEDLKKVSA DREGAPF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658302.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658301.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658300.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658299.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658298.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
TrEMBLC4IYV81e-180C4IYV8_MAIZE; Putative POX domain/homeobox DNA-binding domain family protein
STRINGGRMZM2G076272_P011e-180(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365